rafflesia binary:
Commands
--database accepts a database ID or slug and uses its advertised release.
--release-id pins the API’s database_release_id instead.
Use --json for the complete JSON response and --help for all flags.Documentation Index
Fetch the complete documentation index at: /llms.txt
Use this file to discover all available pages before exploring further.
Search the public Rafflesia API from a terminal.
rafflesia binary:
curl -fsSL https://rafflesia.ai/install.sh | sh
export RAFFLESIA_API_KEY=sk_production_…
rafflesia homology search \
--sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV \
--database tomato \
--limit 10
rafflesia homology databases list
rafflesia homology releases list <database_id>
rafflesia homology search
--database accepts a database ID or slug and uses its advertised release.
--release-id pins the API’s database_release_id instead.
Use --json for the complete JSON response and --help for all flags.